PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.B02800.1.p
Common NameEUGRSUZ_B02800, LOC104433136
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 319aa    MW: 35918.2 Da    PI: 8.7921
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.B02800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding28.24.5e-093378346
                      SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqk 46
                      +WT+eE +++ ++ + + ++   +W+++a+ ++ g+t  ++   ++ 
  Eucgr.B02800.1.p 33 KWTPEENKRFENLLAVYDKDtpdRWAKVAASIP-GKTVGDVMKQYRE 78
                      8********************************.****999998875 PP

2Myb_DNA-binding46.86.9e-15141185347
                       SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       +WT+eE+ +++ + k++G+g+W+ I+r++ + Rt+ q+ s+ qky
  Eucgr.B02800.1.p 141 PWTEEEHRQFLMGLKKYGKGDWRNISRYFVTSRTPTQVASHAQKY 185
                       8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.3E-52779IPR009057Homeodomain-like
PROSITE profilePS512937.5562984IPR017884SANT domain
SMARTSM007174.5E-103082IPR001005SANT/Myb domain
SuperFamilySSF466891.1E-113286IPR009057Homeodomain-like
PfamPF002491.3E-73378IPR001005SANT/Myb domain
CDDcd001678.18E-83379No hitNo description
Gene3DG3DSA:1.10.10.601.4E-12132186IPR009057Homeodomain-like
PROSITE profilePS5129419.092134190IPR017930Myb domain
SuperFamilySSF466891.04E-17136189IPR009057Homeodomain-like
TIGRFAMsTIGR015572.3E-17137189IPR006447Myb domain, plants
SMARTSM007172.3E-13138188IPR001005SANT/Myb domain
CDDcd001672.20E-11141186No hitNo description
PfamPF002493.3E-12141185IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MLLASREMNR GIEILSPYLQ NSNWLFQESK GTKWTPEENK RFENLLAVYD KDTPDRWAKV  60
AASIPGKTVG DVMKQYRELE EDVSDIEAGL IPIPGYGGNS FTLEWINSNN GSDGLKQLYS  120
TVGKRGTSTK PSDQERKKGV PWTEEEHRQF LMGLKKYGKG DWRNISRYFV TSRTPTQVAS  180
HAQKYFIRQG TGGKDKRRSS IHDITTVHLP DSDPPSPVKR QSASPDNSST ITKLPVQAQP  240
HDHHPKIEEM STDILCWNNQ SNGGLVTAYD QVGVDAALGP FRGISSYGNK LHEQRFLMSG  300
LHGAQFDPYF QMQPMHYQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A3e-1731104884RADIALIS
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00296DAPTransfer from AT2G38090Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.B02800.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010044094.10.0PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H71e-100DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A059D6J40.0A0A059D6J4_EUCGR; Uncharacterized protein
STRINGPOPTR_0006s09860.11e-144(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM122827100
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38090.11e-114MYB family protein